PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.006G133700.1.p
Common NameSb06g021350, SORBIDRAFT_06g021350
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family bZIP
Protein Properties Length: 379aa    MW: 39813.1 Da    PI: 6.0486
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.006G133700.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_132.81.5e-10187245563
                           CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                           kr++r   NR +A rs +RK  +i+eLe+kv++L++e ++L  +l +l+     l+se+
  Sobic.006G133700.1.p 187 KRAKRILANRQSAARSKERKMRYIAELERKVQNLQSEATTLSAQLAMLQRDTTGLTSEN 245
                           9***********************************************99999888887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003382.4E-17183247IPR004827Basic-leucine zipper domain
PfamPF077167.2E-8185236IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.174185248IPR004827Basic-leucine zipper domain
SuperFamilySSF579599.85E-11187242No hitNo description
Gene3DG3DSA:1.20.5.1705.9E-11187242No hitNo description
CDDcd147036.74E-24188237No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 379 aa     Download sequence    Send to blast
MDQASPADPA ASCSASASPS PSASAAASAA ASASGDVAAM LPDSPPRRGA GHRRAQSEIL  60
LGGAALPDDL TFDADLGVVG EACVAGDEDE EDEDEDEEGG GGGAGGSRMF EMFLENGGTL  120
AGPSAHPHPA ATATPPPRPR HQHSMSMDGS TSLLGSAAAG TPGRAGADAK KAISDAKLAE  180
LALVDPKRAK RILANRQSAA RSKERKMRYI AELERKVQNL QSEATTLSAQ LAMLQRDTTG  240
LTSENSDLKV RVQTMEQQVR LQDALNDRLR DEIQQLKVAT GQVNANIGKM GNFSMSSFGG  300
NPQSYQRSHI QSLLAAQQLQ QLQIHSQHQQ QQTHLQQQHQ LLQEAHPFPV DLKMRGFAMS  360
SHAQNAGASD SHAVKSEP*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0664680.0BT066468.1 Zea mays full-length cDNA clone ZM_BFb0003G23 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002448110.10.0hypothetical protein SORBIDRAFT_06g021350
SwissprotQ040886e-91POF21_ARATH; Probable transcription factor PosF21
TrEMBLC5YBG00.0C5YBG0_SORBI; Putative uncharacterized protein Sb06g021350
STRINGSb06g021350.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP123022937
Representative plantOGRP12617181
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G06070.16e-75bZIP family protein